PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00029221-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 68aa    MW: 7609.61 Da    PI: 10.9457
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00029221-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-111250140
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                        +g+W++eEde l ++v+  G ++W  I++ +  gR++k+c
  WALNUT_00029221-RA 12 KGPWSPEEDEMLRKLVQGKGARSWYVISKAIA-GRSGKSC 50
                        79******************************.******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-11650IPR009057Homeodomain-like
PROSITE profilePS5129412.837768IPR017930Myb domain
SMARTSM007171.5E-41160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-131150IPR009057Homeodomain-like
PfamPF002497.5E-111250IPR001005SANT/Myb domain
CDDcd001677.97E-91450No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MEASQRDVDR VKGPWSPEED EMLRKLVQGK GARSWYVISK AIAGRSGKSC GFVGATNFHR  60
RWSTGPSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015893041.16e-20PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW18e-16MYB44_ARATH; Transcription factor MYB44
TrEMBLM1CC467e-18M1CC46_SOLTU; Uncharacterized protein
TrEMBLM5VUC34e-18M5VUC3_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000643062e-17(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.11e-17myb domain protein 70